Loading...
Statistics
Advertisement

Newtowne Grille | Restaurant | Bar | Cambridge | Billerica | ...
www.newtownegrille.com/
Restaurant and Bar in Cambridge and Billerica with weekly entertainment, music, sports

Newtownegrille.com

Advertisement
Conversion Technology Metas Server
Newtownegrille.com is hosted in United States / Provo . Newtownegrille.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Google Font API, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.10.1.

Technologies in use by Newtownegrille.com

Technology

Number of occurences: 3
  • CSS
  • Google Font API
  • Html

Advertisement

Server Type

  • nginx/1.10.1

Conversion rate optimization
visitors Clickable call number Founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Newtownegrille.com

Missing HTTPS protocol.

    Meta - Newtownegrille.com

    Number of occurences: 4
    • Name:
      Content:
    • Name: description
      Content: Restaurant and Bar in Cambridge and Billerica with weekly entertainment, music, sports
    • Name: keywords
      Content: restaurant, bar, food, drinks, burgers, pizza, take-out, billerica, cambridge, massachusetts, entertainment, sports
    • Name: viewport
      Content: width=device-width

    Server / Hosting

    • IP: 173.254.96.244
    • Latitude: 40.22
    • Longitude: -111.61
    • Country: United States
    • City: Provo

    Rname

    • ns1.rhostbh.com
    • ns2.rhostbh.com
    • newtownegrille.com

    Target

    • root.rsb32.rhostbh.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Sun, 04 Sep 2016 05:13:30 GMT Content-Type: text/html Content-Length: 4718 Last-Modified: Thu, 14 Aug 2014 15:04:49 GMT Accept-Ranges: bytes Vary: Accept-Encoding X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

    DNS

    host: newtownegrille.com
    1. class: IN
    2. ttl: 56
    3. type: A
    4. ip: 173.254.96.244
    host: newtownegrille.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.rhostbh.com
    host: newtownegrille.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.rhostbh.com
    host: newtownegrille.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.rhostbh.com
    5. rname: root.rsb32.rhostbh.com
    6. serial: 2015111300
    7. refresh: 86400
    8. retry: 7200
    9. expire: 3600000
    10. minimum-ttl: 300
    host: newtownegrille.com
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 0
    5. target: newtownegrille.com
    host: newtownegrille.com
    1. class: IN
    2. ttl: 14400
    3. type: TXT
    4. txt: v=spf1 a mx ptr include:rhostbh.com ?all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ewtownegrille.com, www.nnewtownegrille.com, www.newtownegrille.com, www.nhewtownegrille.com, www.hewtownegrille.com, www.njewtownegrille.com, www.jewtownegrille.com, www.nkewtownegrille.com, www.kewtownegrille.com, www.nlewtownegrille.com, www.lewtownegrille.com, www.n ewtownegrille.com, www. ewtownegrille.com, www.nwtownegrille.com, www.nexwtownegrille.com, www.nxwtownegrille.com, www.neswtownegrille.com, www.nswtownegrille.com, www.newwtownegrille.com, www.nwwtownegrille.com, www.nerwtownegrille.com, www.nrwtownegrille.com, www.nefwtownegrille.com, www.nfwtownegrille.com, www.nevwtownegrille.com, www.nvwtownegrille.com, www.necwtownegrille.com, www.ncwtownegrille.com, www.neqwtownegrille.com, www.nqwtownegrille.com, www.neawtownegrille.com, www.nawtownegrille.com, www.neywtownegrille.com, www.nywtownegrille.com, www.netownegrille.com, www.new townegrille.com, www.ne townegrille.com, www.newctownegrille.com, www.nectownegrille.com, www.newtownegrille.com, www.netownegrille.com, www.newdtownegrille.com, www.nedtownegrille.com, www.newftownegrille.com, www.neftownegrille.com, www.newgtownegrille.com, www.negtownegrille.com, www.newbtownegrille.com, www.nebtownegrille.com, www.newownegrille.com, www.newtqownegrille.com, www.newqownegrille.com, www.newtaownegrille.com, www.newaownegrille.com, www.newt ownegrille.com, www.new ownegrille.com, www.newtwownegrille.com, www.newwownegrille.com, www.newteownegrille.com, www.neweownegrille.com, www.newtzownegrille.com, www.newzownegrille.com, www.newtxownegrille.com, www.newxownegrille.com, www.newtcownegrille.com, www.newcownegrille.com, www.newtwnegrille.com, www.newtobwnegrille.com, www.newtbwnegrille.com, www.newtohwnegrille.com, www.newthwnegrille.com, www.newtogwnegrille.com, www.newtgwnegrille.com, www.newtojwnegrille.com, www.newtjwnegrille.com, www.newtomwnegrille.com, www.newtmwnegrille.com, www.newto wnegrille.com, www.newt wnegrille.com, www.newtovwnegrille.com, www.newtvwnegrille.com, www.newtonegrille.com, www.newtow negrille.com, www.newto negrille.com, www.newtowcnegrille.com, www.newtocnegrille.com, www.newtownegrille.com, www.newtonegrille.com, www.newtowdnegrille.com, www.newtodnegrille.com, www.newtowfnegrille.com, www.newtofnegrille.com, www.newtowgnegrille.com, www.newtognegrille.com, www.newtowbnegrille.com, www.newtobnegrille.com, www.newtowegrille.com, www.newtownnegrille.com, www.newtownegrille.com, www.newtownhegrille.com, www.newtowhegrille.com, www.newtownjegrille.com, www.newtowjegrille.com, www.newtownkegrille.com, www.newtowkegrille.com, www.newtownlegrille.com, www.newtowlegrille.com, www.newtown egrille.com, www.newtow egrille.com, www.newtowngrille.com, www.newtownexgrille.com, www.newtownxgrille.com, www.newtownesgrille.com, www.newtownsgrille.com, www.newtownewgrille.com, www.newtownwgrille.com, www.newtownergrille.com, www.newtownrgrille.com, www.newtownefgrille.com, www.newtownfgrille.com, www.newtownevgrille.com, www.newtownvgrille.com, www.newtownecgrille.com, www.newtowncgrille.com, www.newtowneqgrille.com, www.newtownqgrille.com, www.newtowneagrille.com, www.newtownagrille.com, www.newtowneygrille.com, www.newtownygrille.com, www.newtownerille.com, www.newtownegsrille.com, www.newtownesrille.com, www.newtownegxrille.com, www.newtownexrille.com, www.newtownegyrille.com, www.newtowneyrille.com, www.newtowneghrille.com, www.newtownehrille.com, www.newtownegnrille.com, www.newtownenrille.com, www.newtownegcrille.com, www.newtownecrille.com, www.newtownegdrille.com, www.newtownedrille.com, www.newtownegerille.com, www.newtowneerille.com, www.newtownegrrille.com, www.newtownerrille.com, www.newtownegtrille.com, www.newtownetrille.com, www.newtownegbrille.com, www.newtownebrille.com, www.newtownegvrille.com, www.newtownevrille.com, www.newtownegille.com, www.newtownegriille.com, www.newtownegiille.com, www.newtownegroille.com, www.newtownegoille.com, www.newtownegrlille.com, www.newtowneglille.com, www.newtownegrlille.com, www.newtowneglille.com, www.newtownegr.ille.com, www.newtowneg.ille.com,

    Other websites we recently analyzed

    1. ROBERTO SOZZI - FINE ART PHOTOGRAPHY
      FINE ART CONTEMPORARY PHOTOGRAPHY
      Arezzo (Italy) - 31.11.33.182
      Server software: Apache
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 11
    2. Arackal
      With over 12 years of experience delivering to clients all over the world, Arackal helps start-ups or well-established companies effectively navigate today's modern technology landscape with a focus o
      Wayne (United States) - 74.208.165.106
      Server software: squid/3.5.9
      Technology: CSS, Flexslider, Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 6
    3. wesvirginfatdiminishersystem.com
      Ashburn (United States) - 54.243.49.127
      Server software: Apache/2.2.22 (Debian) mod_qos/10.8
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 3
    4. WAYCO Equipment Ltd
      Wayco Equipment distributes automotive workshop equipment. Brands include Wayco, Rokit Air and KC Tools
      Australia - 202.124.241.203
      Server software: LiteSpeed
      Technology: Html
      Number of Javascript: 2
      Number of meta tags: 5
    5. Tax Sentinel
      San Francisco (United States) - 192.241.207.240
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: BootstrapCDN, Maxcdn, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Wordpress
      Number of Javascript: 17
      Number of meta tags: 3
    6. Personal Injury Attorneys - Accident Lawyers
      If you have been seriously hurt, please contact our skilled personal injury attorneys.
      Herndon (United States) - 64.34.165.173
      G Analytics ID: UA-23139809-4
      Server software: Apache/2.2.22 (Unix) mod_ssl/2.2.22 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 PHP/5.3.14
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 6
    7. Home - Back2Wood
      Germany - 85.13.144.74
      Server software: Apache
      Technology: CSS, Html, Html5, jQuery Colorbox, jQuery UI, MediaElement, Php, Swf Object
      Number of Javascript: 6
      Number of meta tags: 6
    8. nationalapartmentsource.net
      Houston (United States) - 192.254.250.178
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 2
    9. gannalyzer.net
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. TAG Solutions Home - TAG Solutions
      Chicago (United States) - 209.188.95.228
      G Analytics ID: UA-58783198-1
      Server software: Apache
      Technology: CSS, Font Awesome, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
      Number of Javascript: 19
      Number of meta tags: 3

    Check Other Websites